PMM2 (CDG1, CDG1a, CDGS)

Size

£685.00

SKU:: 470116
Application:: WB
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-246 from full length human PMM2.
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The protein encoded by this gene catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Mutations in this gene have been shown to cause defects in glycoprotein biosynthesis, which manifests as carbohydrate-deficient glycoprotein syndrome type I. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQ KIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLV AYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPK KRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENI RQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKR YCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTM GYSVTAPEDTRRICELLFS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.