470110
PLAUR (CD87, UPAR, URKR)
Size
£685.00
- SKU:
- 470110
- Application:
- WB
- Purity:
- Ascites
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-335 from full length human PLAUR.
- Format:
- Supplied as a liquid. No preservative added.
- Extra Details:
- This gene encodes the receptor for urokinase plasminogen activator and, given its role in localizing and promoting plasmin formation, likely influences many normal and pathological processes related to cell-surface plasminogen activation and localized degradation of the extracellular matrix. It binds both the proprotein and mature forms of urokinase plasminogen activator and permits the activation of the receptor-bound pro-enzyme by plasmin. The protein lacks transmembrane or cytoplasmic domains and may be anchored to the plasma membrane by a glycosyl-phosphatidylinositol (GPI) moiety following cleavage of the nascent polypeptide near its carboxy-terminus. However, a soluble protein is also produced in some cell types. Alternative splicing results in multiple transcript variants encoding different isoforms. The proprotein experiences several post-translational cleavage reactions that have not yet been fully defined. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRV EECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKT NRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYS RSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLD VVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFH NNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSC KGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQ SYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSG CNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWG GTLLWT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice