470109
PLA2G4B (HsT16992, PLA2G4B, cPLA2-beta)
Size
£685.00
- SKU:
- 470109
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-316 from full length human PLA2G4B.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene transcribes naturally-occurring mRNAs that are co-transcribed products of the neighboring JMJD7 and PLA2G4B genes. Incompletely processed read-through transcripts from these two loci are abundantly expressed in most tissues, but the function of the predicted protein product has not yet been determined. Alternative splicing of this gene results in different transcript variants, some of which are candidates for nonsense-mediated decay (NMD). [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTP LHFYRDWVCPNRPCIIRNALQHWPALQKWSLPYFRAT VGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSF VLDVLEGRAQHPGVLYVQKQCSNLPSELPQLLPDLES HVPWASEALGKMPDAVNFWLGEAAAVTSLHKDHYEN LYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEG TFKVVDEEAMEKVPWIPLDPLAPDLARYPSYSQAQAL RCTVRAGEMLYLPALWFHHVQQSQGCIAVNFWYDME YDLKYSYFQLLDSLTKASGLD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice