PCGF3 (DKFZp686D20235, DONG1, FLJ36550, FLJ43813, MGC129615, MGC40413, RNF3, RNF3A)

Size

£685.00

SKU:: 470100
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-242 from full length human PCGF3
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The protein encoded by this gene contains a C3HC4 type RING finger, which is a motif known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA sequence: MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCR SCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDI VYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCS AKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHR SDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKF IAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFK KAPLLLHYRPKMDLL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.