470096
OMP
Size
£685.00
- SKU:
- 470096
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-163 from full length human OMP
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse knockout studies show that OMP-null mice are compromised in their ability to respond to odor stimuli, and that OMP represents a novel modulatory component of the odor detection/signal transduction cascade. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRG EKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVL DKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRK EDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGE GVEPANLKASVVFNQL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice