470093
NUP54 (MGC13407)
Size
£685.00
- SKU:
- 470093
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-507 from full length human NUP54.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. This gene encodes a member of the phe-gly (FG) repeat-containing nucleoporin subset. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAFNFGAPSGTSGTAAATAAPAGGFGGFGTTSTTAG SAFSFSAPTNTGTTGLFGGTQNKGFGFGTGFGTTTGT STGLGTGLGTGLGFGGFNTQQQQQTTLGGLFSQPTQ APTQSNQLINTASALSAPTLLGDERDAILAKWNQLQAF WGTGKGYFNNNIPPVEFTQENPFCRFKAVGYSCMPS NKDEDGLVVLVFNKKETEIRSQQQQLVESLHKVLGGN QTLTVNVEGTKTLPDDQTEVVIYVVERSPNGTSRRVP ATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQ LLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKEL LRRLKVQDQMTKQHQTRLDIISEDISELQKNQTTSVAKI AQYKRKLMDLSHRTLQVLIKQEIQRKSGYAIQADEEQL RVQLDTIQGELNAPTQFKGRLNELMSQIRMQNHFGAV RSEERYYIDADLLREIKQHLKQQQEGLSHLISIIKDDLED IKLVEHGLNETIHIRGGVFS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice