470092
NUDT4 (DIPP2, DIPP2alpha, DIPP2beta, DKFZp686I1281, HDCMB47P, KIAA0487)
Size
£685.00
- SKU:
- 470092
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-180 from full length human NUDT4.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular switching by diphosphoinositol polyphosphates may contribute to regulating intracellular trafficking. Several alternatively spliced transcript variants have been described, but the full-length nature of some variants has not been determined. Isoforms DIPP2 alpha and DIPP2 beta are distinguishable from each other solely by DIPP2 beta possessing one additional aa due to intron boundary skidding in alternate splicing. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLL VSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAG VKGKLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDS VNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCS PANGNSTVPSLPDNNALFVTAAQTSGLPSSVR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice