NPTX1 (DKFZp686J2446, MGC105123, NP1)

Size

£685.00

SKU:: 470087
Application:: WB
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-432 from full length human NPTX1
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: NPTX1 is a member of the neuronal pentraxin gene family. Neuronal pentraxin 1 is similar to the rat NP1 gene which encodes a binding protein for the snake venom toxin taipoxin. Human NPTX1 mRNA is exclusively localized to the nervous system. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPAGRAARTCALLALCLLGAGAQDFGPTRFICTSVPV DADMCAASVAAGGAEELRSSVLQLRETVLQQKETILS QKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQP GSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLE QYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEE GKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNR PGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLK SSATPGVGTPFSYAVPGQANELVLIEWGNNPMEILIND KVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQ GGSGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQ AFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIA WAESHIEIYGGATKWTFEACRQIN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.