NOL5A (NOP56)

Size

£685.00

SKU:: 470086
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa49-174 from full length human NOL5A
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. The protein encoded by this gene is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them has not been determined. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSK PKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEET VNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKS SSKKKKKFHKASQED Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.