470082
NDRG2 (KIAA1248, SYLD) (Not for Export EU)
Size
£685.00
- SKU:
- 470082
- Application:
- WB
- Purity:
- Serum
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-360 from full length human NDRG2
- Format:
- Supplied as a liquid. No preservative added.
- Extra Details:
- This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAELQEVQITEEKPLLPGQTPEAAKEAELAARILLDQG QTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYK SCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFP LGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYIL ARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGL TSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDN IELYWNSYNNRRDLNFERGGDITLRCPVMLVVECNSK LDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGM GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLS QSSESGTLSSGPPGHTMEVSC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice