470078
MYOC (GLC1A, GPOA, JOAG, JOAG1, TIGR, myocilin)
Size
£685.00
- SKU:
- 470078
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-504 from full length human MYOC.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- MYOC encodes the protein myocilin, which is believed to have a role in cytoskeletal function. MYOC is expressed in many occular tissues, including the trabecular meshwork, and was revealed to be the trabecular meshwork glucocorticoid-inducible response protein (TIGR). The trabecular meshwork is a specialized eye tissue essential in regulating intraocular pressure, and mutations in MYOC have been identified as the cause of hereditary juvenile-onset open-angle glaucoma. [provided by RefSeq] Applications: Suitable for use in Flow Cytometry, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRFFCARCCSFGPEMPAVQLLLLACLVWDVGARTAQ LRKANDQSGRCQYTFSVASPNESSCPEQSQAMSVIH NLQRDSSTQRLDLEATKARLSSLESLLHQLTLDQAARP QETQEGLQRELGTLRRERDQLETQTRELETAYSNLLR DKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQ CPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTE VPASRILKESPSGYLRSGEGDTGCGELVWVGEPLTLR TAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDV RQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGS LYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPY SWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPE NLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADAT VNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLF AWDNLNMVTYDIKLSKM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice