470076
MYCBP (AMY-1)
Size
£685.00
- SKU:
- 470076
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-103 from full length human MYCBP
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- The MYCBP gene encodes a protein that binds to the N-terminal region of MYC (MIM 190080) and stimulates the activation of E box-dependent transcription by MYC.[supplied by OMIM] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEE PEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEK YEAIVEENKKLKAKLAQYEPPQEEKRAE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice