MVD (FP17780, MPD)

Size

£685.00

SKU:: 470075
Application:: WB
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-400 from full length human MVD
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: The enzyme mevalonate pyrophosphate decarboxylase catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate in one of the early steps in cholesterol biosynthesis. It decarboxylates and dehydrates its substrate while hydrolyzing ATP. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSL SVTLHQDQLKTTTTAVISKDFTEDRIWLNGREEDVGQP RLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVAS VNNFPTAAGLASSAAGYACLAYTLARVYGVESDLSEV ARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQV APESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPL LRFRAESVVPARMAEMARCIRERDFPSFAQLTMKDSN QFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKV AYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGD TFLKGLQVRPAPLSAELQAALAMEPTPGGVKYIIVTQV GPGPQILDDPCAHLLGPDGLPKPAA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.