470074
MTM1 (CNM, MTMX, XLMTM)
Size
£685.00
- SKU:
- 470074
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-603 from full length human MTM1.
- Format:
- Supplied as a liquid in PBS, pH 7.4
- Extra Details:
- This gene encodes a dual-specificity phosphatase that acts on both phosphotyrosine and phosphoserine. It is required for muscle cell differentiation and mutations in this gene have been identified as being responsible for X-linked myotubular myopathy. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASASTSKYNSHSLENESIKRTSRDGVNRDLTEAVPR LPGETLITDKEVIYICPFNGPIKGRVYITNYRLYLRSLET DSSLILDVPLGVISRIEKMGGATSRGENSYGLDITCKD MRNLRFALKQEGHSRRDMFEILTRYAFPLAHSLPLFAF LNEEKFNVDGWTVYNPVEEYRRQGLPNHHWRITFINK CYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVL SWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIR ETNKQISKLTIYDARPSVNAVANKATGGGYESDDAYH NAELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSL ESTHWLEHIKLVLTGAIQVADKVSSGKSSVLVHCSDG WDRTAQLTSLAMLMLDSFYRSIEGFEILVQKKWISFGH KFASRIGHGDKNHTDADRSPIFLQFIDCVWQMSKQFP TAFEFNEQFLIIILDHLYSCRFGTFLFNCESARERQKVT ERTVSLWSLINSNKEKFKNPFYTKEINRVLYPVASMRH LELWVNYYIRWNPRIKQQQPNPVEQRYMELLALRDEY IKRLEELQLANSAKLSDPPTSPSSPSQMMPHVQTHF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice