METTL1 (C12orf1, FLJ95748, TRM8, YDL201w)

Size

£685.00

SKU:: 470067
Application:: WB
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-276 from full length human METTL1.
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLR YPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEK RAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVK VSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNF FYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAY VLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLED LSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDP VLQAVTSQTSLPGH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.