470055
LIMK2
Size
£685.00
- SKU:
- 470055
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-686 from full length human LIMK2
- Format:
- Supplied as a liquid in PBS, pH 7.4
- Extra Details:
- There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGSYLSVPAYFTSRDLFRCSECQDSLTNWYYEKDGK LYCPKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHP ECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLA PMFERLSTESVQEQLPYSVTLISMPATTEGRRGFSVS VESACSNYATTVQVKEVNRMHISPNNRNAIHPGDRILE INGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPVSQRLD QLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRR SLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSS YSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMV MKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLY KDKKLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAK GIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGL SRLIVEERKRAPMEKATTKKRTLRKNDRKKRYTVVGN PYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADP DCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCR LEPESRAPPGAAGEGPGCADDEGPVRRQGKVTIKYD PKELRKHLNLEEWILEQLTRLYDCQEEEISELEIDVDEL LDMESDDAWASRVKELLVDCYKPTEAFISGLLDKIRAM QKLSTPQKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice