470053
KYNU
Size
£685.00
- SKU:
- 470053
- Application:
- WB
- Purity:
- Ascites
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-307 from full length human KYNU.
- Format:
- Supplied as a liquid. No preservative added.
- Extra Details:
- Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDK LRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLG LQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDE SIVGLMKDIVGANEKEIALMNALTVNLHLLMLSFFKPTP KRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKP REGEETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFN IPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDF ACWCSYKYLNAGAGGIAGAFIHEKHAHTIKPARSEFFN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice