470052
KRT9 (CK-9, EPPK, K9)
Size
£685.00
- SKU:
- 470052
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-623 from full length human KRT9.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes the type I keratin 9, an intermediate filament chain expressed only in the terminally differentiated epidermis of palms and soles. Mutations in this gene cause epidermolytic palmoplantar keratoderma. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSCRQFSSSYLSRSGGGGGGGLGSGGSIRSSYSRFS SSGGGGGGGRFSSSSGYGGGSSRVCGRGGGGSFG YSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGY SSSGGFGGGFGGGSGGGFGGGYGSGFGGFGGFGG GAGGGDGGILTANEKSTMQELNSRLASYLDKVQALEE ANNDLENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKD QIVDLTVGNNKTLLDIDNTRMTLDDFRIKFEMEQNLRQ GVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMAL KKNHKEEMSQLTGQNSGDVNVEINVAPGKDLTKTLND MRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEV QSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDT KNRYCGQLQMIQEQISNLEAQITDVRQEIECQNQEYSL LLSIKMRLEKEIETYHNLLEGGQEDFESSGAGKIGLGG RGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSG SRGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSG GSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSG SRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGG GYGGGSGKSSHS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice