470051
KRT4 (CK4, CYK4, FLJ31692, K4)
Size
£685.00
- SKU:
- 470051
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-534 from full length human KRT4.
- Format:
- Supplied as a liquid in PBS, pH 7.4
- Extra Details:
- The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in differentiated layers of the mucosal and esophageal epithelia with family member KRT13. Mutations in these genes have been associated with White Sponge Nevus, characterized by oral, esophageal, and anal leukoplakia. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMS GGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGA CFGGAGGFGTGGFGAGGFGAGFGTGGFGGGFGGSF SGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEIDPEIQK VRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWN LLQQQTTTTSSKNLEPLFETYLSVLRKQLDTLGNDKGR LQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKK DVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQ THVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRS KAEAEALYQTKVQQLQISVDQHGDNLKNTKSEIAELNR MIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAH SKRVELEAALQQAKEELARMLREYQELMSVKLALDIEI ATYRKLLEGEEYRMSGECQSAVSISVVSGSTSTGGIS GGLGSGSGFGLSSGFGSGSGSGFGFGGSVSGSSSS KIISTTTLNKRR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice