470050
KRT16 (CK16, K16, K1CP, KRT16A, NEPPK)
Size
£685.00
- SKU:
- 470050
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-473 from full length human KRT16.
- Format:
- Supplied as a liquid in PBS, pH 7.4
- Extra Details:
- The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAG GSCRAPSTYGGGLSVSSRFSSGGACGLGGGYGGGF SSSSSFGSGFGGGYGGGLGAGFGGGLGAGFGGGFA GGDGLLVGSEKVTMQNLNDRLASYLDKVRALEEANAD LEVKIRDWYQRQRPSEIKDYSPYFKTIEDLRNKIIAATIE NAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNG LRRVLDELTLARTDLEMQIEGLKEELAYLRKNHEEEML ALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQM AEKNRRDAETWFLSKTEELNKEVASNSELVQSSRSEV TELRRVLQGLEIELQSQLSMKASLENSLEETKGRYCM QLSQIQGLIGSVEEQLAQLRCEMEQQSQEYQILLDVKT RLEQEIATYRRLLEGEDAHLSSQQASGQSYSSREVFT SSSSSSSRQTRPILKEQSSSSFSQGQSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice