470044
KEL (CD238, ECE3)
Size
£685.00
- SKU:
- 470044
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-732 from full length human KEL.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a type II transmembrane glycoprotein that is the highly polymorphic Kell blood group antigen. The Kell glycoprotein links via a single disulfide bond to the XK membrane protein that carries the Kx antigen. The encoded protein contains sequence and structural similarity to members of the neprilysin (M13) family of zinc endopeptidases. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEGGDQSEEEPRERSQAGGMGTLWSQESTPEERLP VEGSRPWAVARRVLTAILILGLLLCFSVLLFYNFQNCG PRPCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGR AKETNNSFQELATKNKNRLRRILEVQNSWHPGSGEEK AFQFYNSCMDTLAIEAAGTGPLRQVIEELGGWRISGK WTSLNFNRTLRLLMSQYGHFPFFRAYLGPHPASPHTP VIQIDQPEFDVPLKQDQEQKIYAQIFREYLTYLNQLGTL LGGDPSKVQEHSSLSISITSRLFQFLRPLEQRRAQGKL FQMVTIDQLKEMAPAIDWLSCLQATFTPMSLSPSQSLV VHDVEYLKNMSQLVEEMLLKQRDFLQSHMILGLVVTL SPALDSQFQEARRKLSQKLRELTEQPPMPARPRWMK CVEETGTFFEPTLAALFVREAFGPSTRSAAMKLFTAIR DALITRLRNLPWMNEETQNMAQDKVAQLQVEMGASE WALKPELARQEYNDIQLGSSFLQSVLSCVRSLRARIVQ SFLQPHPQHRWKVSPWDVNAYYSVSDHVVVFPAGLL QPPFFHPGYPRAVNFGAAGSIMAHELLHIFYQLLLPGG CLACDNHALQEAHLCLKRHYAAFPLPSRTSFNDSLTFL ENAADVGGLAIALQAYSKRLLRHHGETVLPSLDLSPQQ IFFRSYAQVMCRKPSPQDSHDTHSPPHLRVHGPLSST PAFARYFRCARGALLNPSSRCQLW Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice