470043
INS-IGF2
Size
£685.00
- SKU:
- 470043
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-200 from full length human INS-IGF2.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This locus includes two alternatively spliced read-through transcript variants which align to the INS gene in the 5' region and to the IGF2 gene in the 3' region. One transcript is predicted to encode a protein which shares the N-terminus with the INS protein but has a distinct and longer C-terminus, whereas the other transcript is a candidate for nonsense-mediated decay (NMD). The transcripts are imprinted and are paternally expressed in the limb and eye. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVE ALYLVCGERGFFYTPKTRREAEDLQASALSLSSSTST WPEGLDATARAPPALVVTANIGQAGGSSSRQFRQRAL GTSDSPVLFIHCPGAAGTAQGLEYRGRRVTTELVWEE VDSSPQPQGSESLPAQPPAQPAPQPEPQQAREPSPE VSCCGLWPRRPQRSQN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice