470027
HNRPUL1 (E1B-AP5, E1BAP5, FLJ12944, HNRNPUL1)
Size
£685.00
- SKU:
- 470027
- Purity:
- Ascites
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-804 from full length human HNRPUL1.
- Format:
- Supplied as a liquid. No preservative added.
- Extra Details:
- This gene encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by E1B-55kDa in adenovirus-infected cells. Two transcript variants encoding different isoforms have been found for this gene. Additional variants have also been found, but their full-length natures have not been determined. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAAL EAEEPDDERELDADDEPGRPGHINEEVETEGGSELEG TAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQF YDTQVIKQENESGYERRPLEMEQQQAYRPEMKTEMK QGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRG YFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCD LHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGR VCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQ LGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGC FADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQAL YPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLS ERIRGTVGPKSKAECEILMMVGLPAAGKTTWAIKHAAS NPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLI QQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKM RPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDH AVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQY NEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRY ENRGPPGGNRGGFQNRGGGSGGGGNYRGGFNRSG GGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPP PQQPPPPQPPPQQPPPPPSYSPARNPPGASTYNKNS NIPGSSANTSTPTVSSYSPPQTYPQPSYNQYQQYAQQ WNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice