HMG20A (FLJ10739, HMGX1, HMGXB1)

Size

£685.00

SKU:: 470024
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-347 from full length human HMG20A.
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Applications: Suitable for use in Immunofluorescence, Western Blot, Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVP YSSGATSSTNNPEFVEDLSQGQLLQSESSNAAEGNE QRHEDEQRSKRGGWSKGRKRKKPLRDSNAPKSPLT GYVRFMNERREQLRAKRPEVPFPEITRMLGNEWSKLP PEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFSR KTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFD IPIFTEEFLNHSKAREAELRQLRKSNMEFEERNAALQK HVESMRTAVEKLEVDVIQERSRNTVLQQHLETLRQVL TSSFASMPLPGSGETPTVDTIDSYMNRLHSIILANPQD NENFIATVREVVNRLDR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.