470005
GRIK2 (EAA4, GLR6, GLUK6, GLUR6, MGC74427, MRT6)
Size
£685.00
- SKU:
- 470005
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-353 from full length human GRIK2.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing at multiple sites within the first and second transmembrane domains, which is thought to alter the structure and function of the receptor complex. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. Mutations in this gene have been associated with autosomal recessive mental retardation. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFG GIFEYVESGPMGAEELAFRFAVNTINRNRTLLPNTTLT YDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSA NAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPD FSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKA PSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFD CSHEMAAGILKQALAMGMMTEYYHYIFTTLDLFALDVE PYRYSGVNMTGFRILNTENTQVSSIIEKWSMERLQAPP KPDSGLLDGFMTMEFHSCCPGWSAMARSHLTAASAS WVQAILLPQPPE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice