470003
GPS1 (COPS1, CSN1, MGC71287)
Size
£685.00
- SKU:
- 470003
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-527 from full length human GPS1.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MRDSSAPSSASSSVTDLYCTPHSSRSDLVLPGTAGDF SLSASLSACTLLYEGAVEPMQIDVDPQEDPQNAPDVN YVVENPSLDLEQYAASYSGLMRIERLQFIADHCPTLRV EALKMALSFVQRTFNVDMYEEIHRKLSEATRELQNAP DAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKN YKGNSIKESIRRGHDDLGDHYLDCGDLSNALKCYSRA RDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKA ESTPEIAEQRGERDSQTQAILTKLKCAAGLAELAARKY KQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALATF DRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYAS CLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYF SPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISAR VDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAM MLRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTN M Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice