FRG1 (FRG1A, FSG1) (Not for Export EU)

Size

£685.00

SKU:: 469997
Purity:: Serum
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-258 from full length human FRG1.
Format:: Supplied as a liquid. No preservative added.
Extra Details:: This gene maps to a location 100 kb centromeric of the repeat units on chromosome 4q35 which are deleted in facioscapulohumeral muscular dystrophy (FSHD). It is evolutionarily conserved and has related sequences on multiple human chromosomes but DNA sequence analysis did not reveal any homology to known genes. In vivo studies demonstrate the encoded protein is localized to the nucleolus. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEYSYVKSTKLVLKGTKTKSKKKKSKDKKRKREEDE ETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYIHALDNG LFTLGAPHKEVDEGPSPPEQFTAVKLSDSRIALKSGYG KYLGINSDGLVVGRSDAIGPREQWEPVFQNGKMALLA SNSCFIRCNEAGDIEAKSKTAGEEEMIKIRSCAERETKK KDDIPEEDKGNVKQCEINYVKKFQSFQDHKLKISKEDS KILKKARKDGFLHETLLDRRAKLKADRYCK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.