469995
FOXA3 (FKHH3, HNF3G, MGC10179, TCF3G)
Size
£685.00
- SKU:
- 469995
- Application:
- WB
- Purity:
- Ascites
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-350 from full length human FOXA3.
- Format:
- Supplied as a liquid. No preservative added.
- Extra Details:
- This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAP LNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPL GPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYR RPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMD LFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKP GKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKK GGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAP EPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLD APYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGG EPGVYYQGLYSRSLLNAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice