FARP1 (CDEP, MGC87400, PLEKHC2)

Size

£685.00

SKU:: 469985
Application:: WB
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-129 from full length human FARP1.
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: This gene was originally isolated through subtractive hybridization due to its increased expression in differentiated chondrocytes versus dedifferentiated chondrocytes. The resulting protein contains a predicted ezrin-like domain, a Dbl homology domain, and a pleckstrin homology domain. It is believed to be a member of the band 4.1 superfamily whose members link the cytoskeleton to the cell membrane. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSG KLVSIKIQMLDDTQEAFEVPMVSSSSFLKAIGSSWTGW VLRCSMKPKHHSHLIEKFGEDRILTHLTGSISYTNWAG SRSLAVTVTEELLNLF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.