FAM50A (9F, DXS9928E, HXC-26, XAP5)

Size

£685.00

SKU:: 469983
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-339 from full length human FAM50A.
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRI AEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDM KAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERK KEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMERE EITTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQ EWEAKQEKIKSEEIEITFSYWDGSGHRRTVKMRKGNT MQQFLQKALEILRKDFSELRSAGVEQLMYIKEDLIIPHH HSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKD ESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDK YTIR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.