469978
ERCC8 (CKN1, CSA)
Size
£685.00
- SKU:
- 469978
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-396 from full length human ERCC8.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcription factor IIH. Mutations in this gene have been identified in patients with hereditary disease Cockayne syndrome (CS). CS cells are abnormally sensitive to ultraviolet radiation and are defective in the repair of transcriptionally active genes. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKDRD VERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLEN SSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHD TGMFTSSSFDKTLKVWDTNTLQTADVFNFEETVYSHH MSPVSTKHCLVAVGTRGPKVQLCDLKSGSCSHILQGH RQEILAVSWSPRYDYILATASADSRVKLWDVRRASGC LITLDQHNGKKSQAVESANTAHNGKVNGLCFTSDGLH LLTVGTDNRMRLWNSSNGENTLVNYGKVCNNSKKGL KFTVSCGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGH YKTVDCCVFQSNFQELYSGSRDCNILAWVPSLYEPVP DDDETTTKSQLNPAFEDAWSSSDEEG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice