EIF2C2 (AGO2, MGC3183, Q10)

Size

£843.00

SKU:: 469972
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-377 from full length EIF2C2, fused to GST-Tag.
Clone:: S2
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLV VVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRT TPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFL GADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVR VQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRD GVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQ KRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEF DFYLCSHAGIQGTSRPSHYHVLWDDNRFSSDELQILT YQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKE HDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMY FA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice