469964
DHX30 (DDX30, FLJ11214, KIAA0890, Ret-CoR)
Size
£685.00
- SKU:
- 469964
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-501 from full length human DHX30.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The encoded protein has 97% sequence identity with the mouse HELG protein. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MHESKYLILPVHSNIPMMDQKAIFQQPPVGVRKIVLAT NIAETSITINDIVHVVDSGLHKEERYDLKTKVSCLETVW VSRANVIQRRGRAGRCQSGFAYHLFPRSRLEKMVPF QVPEILRTPLENLVLQAKIHMPEKTAVEFLSKAVDSPNI KAVDEAVILLQEIGVLDQREYLTTLGQRLAHISTDPRLA KAIVLAAIFRCLHPLLVVVSCLTRDPFSSSLQNRAEVDK VKALLSHDSGSDHLAFVRAVAGWEEVLRWQDRSSRE NYLEENLLYAPSLRFIHGLIKQFSENIYEAFLVGKPSDC TLASAQCNEYSEEEELVKGVLMAGLYPNLIQVRQGKV TRQGKFKPNSVTYRTKSGNILLHKSTINREATRLRSRW LTYFMAVKSNGSVFVRDSSQVHPLAVLLLTDGDVHIRD DGRRATISLSDSDLLRLEGDSRTVWLLKELRRALGRM VERSLRSELAALPPSVQEEHGQLLALLAELLRGPCGSF DVRKTADD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice