469959
CYP4Z1 (CYP4A20)
Size
£685.00
- SKU:
- 469959
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-505 from full length human CYP4Z1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 1p33. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEPSWLQELMAHPFLLLILLCMSLLLFQVIRLYQRRRW MIRALHLFPAPPAHWFYGHKEFYPVKEFEVYHKLMEK YPCAVPLWVGPFTMFFSVHDPDYAKILLKRQDPKSAV SHKILESWVGRGLVTLDGSKWKKHRQIVKPGFNISILKI FITMMSESVRMMLNKWEEHIAQNSRLELFQHVSLMTL DSIMKCAFSHQGSIQLDSTLDSYLKAVFNLSKISNQRM NNFLHHNDLVFKFSSQGQIFSKFNQELHQFTEKVIQDR KESLKDKLKQDTTQKRRWDFLDILLSAKSENTKDFSEA DLQAEVKTFMFAGHDTTSSAISWILYCLAKYPEHQQR CRDEIRELLGDGSSITWEHLSQMPYTTMCIKECLRLYA PVVNISRLLDKPITFPDGRSLPAGITVFINIWALHHNPYF WEDPQVFNPLRFSRENSEKIHPYAFIPFSAGLRNCIGQ HFAIIECKVAVALTLLRFKLAPDHSRPPQPVRQVVLKSK NGIHVFAKKVC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice