469958
CYP2U1 (P450TEC)
Size
£685.00
- SKU:
- 469958
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-168 from full length human CYP2U1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme is a hydroxylase that metabolizes arachidonic acid, docosahexaenoic acid, and other long chain fatty acids. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSSPGPSQPPAEDPPWPARLLRAPLGLLRLDPSGGAL LLCGLVALLGWSWLRRRRARGIPPGPTPWPLVGNFG HVLLPPFLRRRSWLSSRTRAAGIDPSVIGPQVLLAHLA RVYGSIFSFFIGHYLVVVLSDFHSVREALVQQAEVFSD RPRVPLISIVTKEKELFQE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice