469955
CRYZL1 (4P11, QOH-1)
Size
£685.00
- SKU:
- 469955
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full-length protein corresponding to aa1-113 from human CRYZL1
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a protein that has sequence similarity to zeta crystallin, also known as quinone oxidoreductase. This zeta crystallin-like protein also contains an NAD(P)H binding site. Alternatively spliced transcript variants have been observed but their full-length nature has not been completely determined. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVK ACALSQINTKLLAEMKMKKDLFPVGREIAGIVLDVGSK VSFFQPDDEVVEVLSRLGAVAHVCNPSTLGGQGGRIT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice