CRYZL1 (4P11, QOH-1)

Size

£685.00

SKU:: 469954
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-113 from full length human CRYZL1
Format:: Supplied as a liquid. No preservative added.
Extra Details:: This gene encodes a protein that has sequence similarity to zeta crystallin, also known as quinone oxidoreductase. This zeta crystallin-like protein also contains an NAD(P)H binding site. Alternatively spliced transcript variants have been observed but their full-length nature has not been completely determined. [provided by RefSeq] Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVK ACALSQINTKLLAEMKMKKDLFPVGREIAGIVLDVGSK VSFFQPDDEVVEVLSRLGAVAHVCNPSTLGGQGGRIT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.