469953
COPE (FLJ13241, epsilon-COP)
Size
£685.00
- SKU:
- 469953
- Application:
- WB
- Purity:
- Purified.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-308 from full length human COPE.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAPPAPGPASGGSGEVDELFDVKNAFYIGSYQQCINE AQRVKLSSPERDVERDVFLYRAYLAQRKFGVVLDEIKP SSAPELQAVRMFADYLAHESRRDSIVAELDREMSRSV DVTNTTFLLMAASIYLHDQNPDAALRALHQGDSLECTA MTVQILLKLDRLDLARKELKRMQDLDEDATLTQLATAW VSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAAC HMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQH LGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDR LVLQYAPSA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice