469952
COMP (EDM1, EPD1, MED, MGC131819, MGC149768, PSACH, THBS5)
Size
£685.00
- SKU:
- 469952
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-724 from full length human COMP.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Mutations can cause the osteochondrodysplasias pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED). [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLRELQETNAALQDVRELLRQQVREITFLKNTVMECD ACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTES GARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCI NTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCT DINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVG DQASGCQRRAQRFCPDGSPSECHEHADCVLERDGS RSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQ CRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVP NEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKND DQKDTDQDGRGDACDDDIDGDRIRNQADNCPRVPNS DQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGD ACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDG QGDACDDDDDNDGVPDSRDNCRLVPNPGQEDADRD GVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQ TVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAV GYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSF YVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTG PGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKK SYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTM RGGRLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLR QA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice