469951
CMTM5 (CKLFSF5, FLJ37521)
Size
£685.00
- SKU:
- 469951
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-156 from full length human CMTM5.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene belongs to the chemokine-like factor gene superfamily. This family of genes encodes multi-pass membrane proteins that are similar to both the chemokine and the transmembrane 4 superfamilies of signaling molecules. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGIL LETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYAT QYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDG AAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice