CHRDL1 (CHL, NRLN1, VOPT, dA141H5.1)

Size

£685.00

SKU:: 469946
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa347-456 from partial CHRDL1, fused to GST-Tag
Clone:: 1D10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes an antagonist of bone morphogenetic protein 4. The encoded protein may play a role in topographic retinotectal projection and in the regulation of retinal angiogenesis in response to hypoxia. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq] Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA sequence: MPVYESVFMEDGETTRKIALETERPPQVEVHVWTIRK GILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFTEG EAQISQMCSSRVCRTELEDLVKVLYLERSEKGHC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.