469942
CEACAM1 (BGP, BGP1, BGPI)
Size
£685.00
- SKU:
- 469942
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-464 from full length human CEACAM1.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a 1.2 Mb cluster on the long arm of chromosome 19. Eleven pseudogenes of the CEA cell adhesion molecule subgroup are also found in the cluster. The encoded protein was originally described in bile ducts of liver as biliary glycoprotein. Subsequently, it was found to be a cell-cell adhesion molecule detected on leukocytes, epithelia, and endothelia. The encoded protein mediates cell adhesion via homophilic as well as heterophilic binding to other proteins of the subgroup. Multiple cellular activities have been attributed to the encoded protein, including roles in the differentiation and arrangement of tissue three-dimensional structure, angiogenesis, apoptosis, tumor suppression, metastasis, and the modulation of innate and adaptive immune responses. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature of only two has been determined. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLT TESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERV DGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQN VTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSI SSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLP VSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSAN RSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAA SNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCH ANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTG DKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQ GNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNV NYNALPQENGLSPGAIAGIVIGVVALVALIAVALACFLHF GKTGSSGPLQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice