469940
CDCA1 (CDCA1, NUF2R)
Size
£685.00
- SKU:
- 469940
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-464 from full length human CDCA1.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a protein that is highly similar to yeast Nuf2, a component of a conserved protein complex associated with the centromere. Yeast Nuf2 disappears from the centromere during meiotic prophase when centromeres lose their connection to the spindle pole body, and plays a regulatory role in chromosome segregation. The encoded protein is found to be associated with centromeres of mitotic HeLa cells, which suggests that this protein is a functional homolog of yeast Nuf2. Alternatively spliced transcript variants that encode the same protein have been described. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: METLSFPRYNVAEIVIHIRNKILTGADGKNLTKNDLYPN PKPEVLHMIYMRALQIVYGIRLEHFYMMPVNSEVMYPH LMEGFLPFSNLVTHLDSFLPICRVNDFETADILCPKAKR TSRFLSGIINFIHFREACRETYMEFLWQYKSSADKMQQ LNAAHQEALMKLERLDSVPVEEQEEFKQLSDGIQELQ QSLNQDFHQKTIVLQEGNSQKKSNISEKTKRLNELKLS VVSLKEIQESLKTKIVDSPEKLKNYKEKMKDTVQKLKN ARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSD NREKLASILKESLNLEDQIESDESELKKLKTEENSFKRL MIVKKEKLATAQFKINKKHEDVKQYKRTVIEDCNKVQE KRGAVYERVTTINQEIQKIKLGIQQLKDAAEREKLKSQE IFLNLKTALEKYHDGIEKAAEDSYAKIDEKTAELKRKMF KMST Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice