469938
CD59 (16.3A5, 1F5, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, HRF-20, HRF20, MAC-IP, MACIF, MEM43, MGC2354, MIC11, MIN1, MIN2, MIN3, MIRL, MSK21, p18-20)
Size
£685.00
- SKU:
- 469938
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-128 from full length human CD59.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTAD CKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFND VTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKT VLLLVTPFLAAAWSLHP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice