469935
CCNF (FBX1, FBXO1)
Size
£685.00
- SKU:
- 469935
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-786 from full length human CCNF.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a member of the cyclin family. Cyclins are important regulators of cell cycle transitions through their ability to bind and activate cyclin-dependent protein kinases. This member also belongs to the F-box protein family which is characterized by an approximately 40aa motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it was one of the first proteins in which the F-box motif was identified. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGSGGVVHCRCAKCFCYPTKRRIRRRPRNLTILSLPE DVLFHILKWLSVEDILAVRAVHSQLKDLVDNHASVWAC ASFQELWPSPGNLKLFERAAEKGNFEAAVKLGIAYLYN EGLSVSDEARAEVNGLKASRFFSLAERLNVGAAPFIWL FIRPPWSVSGSCCKAVVHESLRAECQLQRTHKASILH CLGRVLSLFEDEEKQQQAHDLFEEAAHQGCLTSSYLL WESDRRTDVSDPGRCLHSFRKLRDYAAKGCWEAQLS LAKACANANQLGLEVRASSEIVCQLFQASQAVSKQQV FSVQKGLNDTMRYILIDWLVEVATMKDFTSLCLHLTVE CVDRYLRRRLVPRYRLQLLGIACMVICTRFISKEILTIRE AVWLTDNTYKYEDLVRMMGEIVSALEGKIRVPTVVDY KEVLLTLVPVELRTQHLCSFLCELSLLHTSLSAYAPARL AAAALLLARLTHGQTQPWTTQLWDLTGFSYEDLIPCVL SLHKKCFHDDAPKDYRQVSLTAVKQRFEDKRYGEISQ EEVLSYSQLCAALGVTQDSPDPPTFLSTGEIHAFLSSP SGRRTKRKRENSLQEDRGSFVTTPTAELSSQEETLLG SFLDWSLDCCSGYEGDQESEGEKEGDVTAPSGILDVT VVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDT QIPATPGPKPLVRTSREPGKDVTTSGYSSVSTASPTSS VDGGLGALPQPTSVLSLDSDSHTQPCHHQARKSCLQ CRPPSPPESSVPQQQVKRINLCIHSEEEDMNLGLVRL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice