C6orf206 (FLJ30845, MRPS18AL1)

Size

£685.00

SKU:: 469926
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-276 from full length human C6orf206.
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Radial spokes are regularly spaced along cilia, sperm, and flagella axonemes and have a multisubunit 'stalk' and 'head' that form a signal transduction scaffold between the central microtubule pair and dynein (see MIM 603297) arms. RSPH9 is predicted to be a component of the radial spoke head based on homology with proteins in the biflagellate alga Chlamydomonas reinhardtii and other ciliates (Castleman et al., 2009 [PubMed 19200523]).[supplied by OMIM] Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKR DYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLY SLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEY EHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKA VAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFH FREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWS IQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVG TGEKNMDLPFML Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.