BRCC2 (BRCC2, BRCC@, MGC163233, MGC163235)

Size

£685.00

SKU:: 469909
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-108 from full length human BRCC2.
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a BH3-like motif containing protein involved in cell death. The encoded protein may induce apoptosis in a caspase-dependent manner. The protein is localized in both the cytoplasm and the mitochondrion. [SH] Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVTLLPIEGQEVHFFEILESECVLYTGWIERASGSSIYP EAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAM KRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.