ATP1B3 (ATPB-3, CD298, FLJ29027) (Not for Export EU)

Size

£685.00

SKU:: 469905
Purity:: Serum
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Protein corresponding to aa1-279 from full length human ATP1B3.
Format:: Supplied as a liquid. No preservative added.
Extra Details:: The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. [provided by RefSeq] Applications: Suitable for use in Flow Cytometry, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWG LILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQI PSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFL KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQ ACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRID CVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYL QPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDR DKFLGRVMFKITARA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice