469901
AOC2 (DAO2, RAO)
Size
£685.00
- SKU:
- 469901
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-756 from full length human AOC2.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. This gene shows high sequence similarity to copper amine oxidases from various species ranging from bacteria to mammals. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine. This gene may be a candidate gene for hereditary ocular diseases. Alternate splicing results in multiple transcript variants. [provided by RefSeq] Applications: Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MHLKIVLAFLALSLITIFALAYVLLTSPGGSSQPPHCPSV SHRAQPWPHPGQSQLFADLSREELTAVMRFLTQRLG PGLVDAAQAQPSDNCIFSVELQLPPKAAALAHLDRGS PPPAREALAIVLFGGQPQPNVSELVVGPLPHPSYMRD VTVERHGGPLPYHRRPVLRAEFTQMWRHLKEVELPK APIFLSSTFNYNGSTLAAVHATPRGLRSGDRATWMAL YHNISGVGLFLHPVGLELLLDHRALDPAHWTVQQVFYL GHYYADLGQLEREFKSGRLEVVRVPLPPPNGASSLRS RNSPGPLPPLQFSPQGSQYSVQGNLVVSSLWSFTFG HGVFSGLRIFDVRFQGERIAYEVSVQECVSIYGADSPK TMLTRYLDSSFGLGRNSRGLVRGVDCPYQATMVDIHI LVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFY GGLASSALVVRSVSSVGNYDYIWDFVLYPNGALEGRV HATGYINTAFLKGGEEGLLFGNRVGERVLGTVHTHAF HFKLDLDVAGLKNWVVAEDVVFKPVAAPWNPEHWLQ RPQLTRQVLGKEDLTAFSLGSPLPRYLYLASNQTNAW GHQRGYRIQIHSPLGIHIPLESDMERALSWGRYQLVVT QRKEEESQSSSIYHQNDIWTPTVTFADFINNETLLGED LVAWVTASFLHIPHAEDIPNTVTLGNRVGFLLRPYNFF DEDPSIFSPGSVYFEKGQDAGLCSINPVACLPDLAACV PDLPPFSYHGF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice