469898
ALOX5 (5-LO, 5-LOX, 5LPG, LOG5, MGC163204)
Size
£685.00
- SKU:
- 469898
- Application:
- WB
- Purity:
- Purified
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Protein corresponding to aa1-674 from full length human ALOX5.
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- This gene encodes a member of the lipoxygenase gene family and plays a dual role in the synthesis of leukotrienes from arachidonic acid. The encoded protein, which is expressed specifically in bone marrow-derived cells, catalyzes the conversion of arachidonic acid to 5(S)-hydroperoxy-6-trans-8,11,14-cis-eicosatetraenoic acid, and further to the allylic epoxide 5(S)-trans-7,9-trans-11,14-cis-eicosatetrenoic acid (leukotriene A4). Leukotrienes are important mediators of a number of inflammatory and allergic conditions. Mutations in the promoter region of this gene lead to a diminished response to antileukotriene drugs used in the treatment of asthma and may also be associated with atherosclerosis and several cancers. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. [provided by RefSeq] Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHL LDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKY WLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLR DGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWN PGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAME NLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMN HWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEM VECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLP SDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVF GIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICEC GLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIK ARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYY EGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSV KSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPN APPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGA VWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKN LEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice